Query Sequence
>AO353_08730
MSEIPVDLRFAESHEWARLDEDGGVKVGISDHAQEALGDVVFVELPEIGKVFAAGEAAGVVESVKAASDIYSPVSGTVIAVNEELANSPELVNSAPYDSWFFKLEPTDTSELDKLLDPTGYKHAIGE
Hit FamilyFIG00000296
Hit Family FunctionGlycine cleavage system H protein


back to search