Query Sequence
>AO353_08500
MSYQHQYVDGTRIHFPVGKVVCIGRNYAEHAKELDNPVPTEPLLFIKPGSCVVPLEGGFAIPTERGSVHYEAEIAVLIGKPLSTKPSREEVLDAISGFAPGLDLTLRDKQAELKSKGLPWEISKSFDGACVLAPFVVSSTFPDLTDIGIRLTINGEVRQDGNSSLMLNPIVPMIQYMAGCFSLQAGDVIMTGTPAGVGPLNVGDELVLELPGAGSFKSSVR
Hit FamilyFIG00007658
Hit Family FunctionFumarylacetoacetate hydrolase family protein


back to search