Query Sequence
>AO353_05220
MSLAVIQMVSQSDVPANLIQARHLLEQAAAGGARLAVLPENFAAMGRRDIADIGRAEALGEGPILPWLKQTARDLKLWIVAGTLPLPPVDQPLAKSNACSLLIDEHGDTVARYDKLHLFDVDVADNRGRYRESDDYAHGSKVVVADTPVGRVGLTVCYDLRFPELYSELRAAGAELITAPSAFTAVTGAAHWDVLIRARAIETQCYVLAAAQGGTHPGPRETFGHAAIVDPWGRVLAEQDQGEAVLLAERDSSEQASIRARMPVSSHRRFFSQGAQRPASERGIKA
Hit FamilyFIG01970588
Hit Family FunctionFIG003879: Predicted amidohydrolase / Omega amidase (Nit2 homolog)


back to search