Query Sequence
>AO353_03510
MSTEQLLKTPLHALHIELGARMVPFAGYDMPVQYPLGVMKEHQHTRDQAGLFDVSHMGQIRLTGANAAKALETLVPVDIIDLPVGMQRYAMFTNQNGGILDDLMVANLGNDELFLVVNAACKDQDLAHLRQHIGDQCSIEPLFEERALLALQGPAAVTVLARLAPEVAKMTFMQFTRVTLLGVDCFVSRSGYTGEDGFEISVPAADAEALARALLAEPEVAAIGLGARDSLRLEAGLCLYGHDMNTDTTPIEASLLWAISKPRRADGARAGGFPGAETVFAQQQNGVSRKRVGLLPQERTPVREGAEIVNEAGEIIGSVCSGGFGPTLGGPLAMGYLDSAYIALDTQVWAIVRGKKVPLLVSKMPFVPQRYYRG
Hit FamilyFIG00138538
Hit Family FunctionAminomethyltransferase (glycine cleavage system T protein) (EC 2.1.2.10)


back to search