Query Sequence
>AO353_03310
MIEDFWKDKYPAGIAAEINPDEYPNIQAVLKQSCQRFANKPAFSNLGKTLTYGELYELSGAFAAYLQQHTDLQPGDRIAVQLPNLLQYPIAVFGAIRAGLIVVNTNPLYTAREMEHQFNDSGAKALVCLANMAHLAEAVVPKTGVKHVIVTEVADLLPPLKRLLINSVIKYVKKMVPAYHLPKAVKFNDVLSKGHGQPVTEANPASSDVAVLQYTGGTTGVAKGAMLTHRNLVANMMQCRALMGSNLNEGCEILITPLPLYHIYAFTFHCMAMMLIGNHNILISNPRDLPAMVKELSKWKFSGFVGLNTLFVALCNNEAFRKLDFSGLKITLSGGMALQLAAAERWKAVTGCAICEGYGMTETSPVATVNPNQNIQIGTIGIPVPSTLCKVIDDAGVEQPLGEIGELCVKGPQVMKGYWQRQEATDEILDSEGWLKTGDIALIQPDGYMRIVDRKKDMILVSGFNVYPNELEDVLATLPGVLQCAAIGVPDEKSGEAIKIFIVAKPGVTLTKEQVMTHMRANVTGYKVPRAIEFRDALPTTNVGKILRRELRDEELKKLGLKKVSA
Hit FamilyNo hits found for this sequence


back to search