Query Sequence
>AO353_01660
MSMTFSGQVALVTGAAAGIGRATAQAFAAEGLKVVVADLDVAGGEGTAELIRAAGGEAVFVQCNVTQESDVQNLMAKAVSTYGRLDYAFNNAGIEIEKGKLAEGTLDEFDAIMGVNVKGVWLCMKYQLPLMLAQGGGAIVNTASVAGLGAAPKMSIYAASKHAVIGLTKSAAIEYAKKKIRVNAVCPAVIDTDMFRRAYEADPKKADFAAAMHPVGRIGKVEEIASAVLYLCSDGAAFTTGHSLAVDGGVTAF
Hit FamilyFIG00440067
Hit Family FunctionShort-chain dehydrogenase/reductase SDR


back to search