Query Sequence
>8502295
MRLAQRMESVPRSYIREILKVTAQPDIISFAGGLPHPASFPVDAVASAAASVLEEAGPEALQYTTTEGFPPLRQWIADRYKRQGINVSPDDILITTGSQQALDLVAKACIDRGGRVVMERPGYLGAIQCFSVFGPDFVTVPLTPRGVDTDALRKAATGAQVFYAVPSFQNPSGITYDEQTRREVAEIMAETGCLMVEDNPYGELRFMGQHLPPVRAYMQAPSVLLGSFSKVVSPGLRLGWVCAPQEVLNPMITAKQASDLHTPGFTQRILHRYLMDNDVDKHIASIRARYGAQRDAMVQAIRRHFPEDVACTEPEGGMFLWCTLPEGISAEALFHKAIERKVAFVPGRPFYVDETDDTFRLNFSNSSPELIEEGIARLGQCLREYLGKGQAGAA
Hit FamilyFIG00094525
Hit Family FunctionAromatic-amino-acid aminotransferase (EC 2.6.1.57)


back to search