Query Sequence
>8502147
METTARNAIVTGGSRGIGRAIALRLAQDGFCVVVNYASNAPAALEVVDAIARTGGQAVAVPADVGETGDVEGLFAAAHDAFGQVGVVVNSAGIMPMLPIAGGDTAAFEKVLRTNLTGTFNVLSRAANALTAGGRIIALSTSVIAKPFPGYGPYIASKAGVEGLVRVLANELRGRSITVNAVAPGPVATDLFLNGKTEEQIAAIGKLAPLERLGTPEEIAGVVSFLVGPEGGWINAQVVRVNGGFA
Hit FamilyFIG01411036
Hit Family Functionprobable short-chain dehydrogenase


back to search