Query Sequence
>8501944
MEIARDMTELVGRTPLVRLNRVSEGCAAEVVAKLEFNNPCASVKDRIALAMIDGAMERGELAPGGLLVEPTSGNTGVGLAFVAAVRGLTLVLTMPESMSNERKALLRGFGARLVLTPASKGMRGAIEEAERIVAETPGAVMLGQFVNPDNPLVHRKTTAEEIWADTDGKVDAFVAGVGTGGTVTGTGRRLRELNPDIKVFAVEPDESPVLSGGAPGPHPIQGIGAGFVPPVLDTKVYDEIIRVPGKDALVTARRLLREEGILCGVSSGANAFAAMAVARRPEMAGKRVVFVVCDTGERYLSTPLFTEMPD
Hit FamilyFIG00064110
Hit Family FunctionCysteine synthase (EC 2.5.1.47)


back to search