Query Sequence
>8501322
MPNNTTDTGTPERIFIKGNEAIAHGALAAGCRCYFGYPITPQNDIPEMMSYALPDAGGEFVQAESEVASANMLLGAAAAGIRALTSSSSPGISLMQEAISYMAGSELPGVIVNMNRGGPGLGDIGPSQGDYFQSVKGGGHGDYKLFVLAPATCQECYDMMVQAFDLAFKYRNPVMVLGDAIVGQMKEPVTPWKPAAVPATEAADWRLEGAKGRKPRLLKSLFLEDGALAGQNRHLQAKYAAMQAEAKAESFLTDDAELIVVAYGSIGRIAKSAIRKLRAQGHKVGLVRPQTLFPFPGPLLRGLAEQGKRFLTIEHNCGQMVEDVRLSIRGIVDSAFYGHMPGEMPGSDDFLAPILDAMGGK
Hit FamilyFIG00937303
Hit Family Function2-oxoglutarate oxidoreductase, alpha subunit (EC 1.2.7.3)


back to search