Query Sequence
>8501226
MAEQDHIIELRGVTKTFEDTVALDSIDLTIRNGEFLTLLGPSGCGKTTILRLVSGFEQPTSGEVRINGQVVNRVPPEQRQVNTVFQNYALFPHMTVRDNVAFGLKMQGVAADETARRVLDALRMVHLENFADRKPRQLSGGQQQRVAIARAVINNPLVLLLDEPFSALDFKLRKQMQLEIKHLQRQLGITFVFVTHDQEEAFAMSDRVVVMNEGRIEQIGAPKEIYEEPANMYVARFVGDINALPGRIDAVRLDWSAAPGTPLAPPAPGTPEHAALPPDLKPGEHLYDATVGGTVFPVRSRRRLAPGDGVQVLLRPEDLRIDRIAVAETPDWPHLWGRIEESVYKGATVDLVITLDDGQRLMAAEFFNEDDEDINYNPGERVAVSWVDGWEVLLPDDAA
Hit FamilyFIG00007514
Hit Family FunctionPutrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)


back to search