Query Sequence
>8501185
MALDFKASVMWESVPLLLGGVHLTIIITLGGLAIGFLLGTATGLAKTARGKLPRALADIYVEAIRGTPLIVQVMFLYFGVPLATGMRIPPVTAGIIAIAVNSGAYIAEIVRGAVESIDVGQTEAGRSIGLTRMQTLLYVVWPQAFRRMIPPLGNQFIISLKDTSLLVVIGVGELTRQGQEIIAVNFRAFEVWLTVAVMYLVMTLSIARALRVYERKLNARSGR
Hit FamilyFIG00050908
Hit Family FunctionGlutamate transport membrane-spanning protein


back to search