Query Sequence
>8501181
MPAPTADSAALSTLFEIIGYAAGLLTSLAYLPQVVRIARTRSADDISLPTFRLLAVGVALWLVYGIGIGSWPVMAANAVGLALILAVIWLKLRYSRQL
Hit FamilyFIG00602545
Hit Family FunctionFIG00602546: hypothetical protein


back to search