Query Sequence
>8501005
MNSSKPATLFDAPSRLLVKVCGLTRQQDADACAEAGVDLCGFIFHPASPRGVTPAVAAGLHSHGMARVGVFVKQSADEVLAVMDAARLDFAQLHGGQDAAFCDRVGPERVIRAAWPQRHADRSALQAELAGLAPHVRCFLLDAGTSGGGHGATMDWSALRGLAPGAPWLLAGGLTPDNVASAVAACGGHDPGALIGVDLNSGVESAPGQKDATRVAAALAALRAA
Hit FamilyFIG00069722
Hit Family FunctionPhosphoribosylanthranilate isomerase (EC 5.3.1.24)


back to search