Query Sequence
>8501003
MSAAIHTDMNDMLPEAPVSRLEARVTAANAAGRPALVPFLTAGFPTLDRFWEEMDGLDRGGADVIEIGVPFSDPVADGPVVEAASLRALENGVTLRWILDGLKARAGRYEAELVLMGYYNPFLQYGLENLAADAAAAGVAGFIVPDLPLEEDAEMRALLAARGIDLIALVGPNTSEERMAEYAAVASGYVYVVSVLGITGVREGLPPEVPQTLARARKAFRLPLALGFGIKEPKQLEGFPDRPDAVVFGSALLRHIDAGNSAESFLAAWK
Hit FamilyFIG00105533
Hit Family FunctionTryptophan synthase alpha chain (EC 4.2.1.20)


back to search