Query Sequence
>8500851
MSYVRLVNVTKRFGGVTAVDSLNLEIGRGECFSMLGPSGCGKTTTLRMVAGFEDLDDGEIHVGDRLLSARRNNYYLPPEKRDFGMVFQAFAVWPHLSVYENVAFPLRIRRLSAAEIDRRTREALHHTSLADVAQKSPDDLSGGGKQRVALARALAINPDVMLLDEPLSSLDPHLREEMRFEIKDLQRTFGFSILYVTHDQSEAMALSDRIMVMRNGVVQQVGTPLDVYTNPANSFVFGFIGLSNFLDVNLTPEGLVRVNGGDARVTPATPPSARLVSAGRAALASRPSEIDFTAEGGLRGVVRRRAYLGEIVDYRIDVSGQEVRVQKGRRAPGPAEGDACGLVFLRPHWYDPAA
Hit FamilyFIG00005705
Hit Family FunctionFerric iron ABC transporter, ATP-binding protein


back to search