Query Sequence
>8500849
MADITLAGIGKAYGAHAVLDGLSLTVNHGECFTLLGPSGCGKTVLLRLIAGFETPDAGTISIGGEPVSDAVTGDCVPPDARDLGVVFQDYAVWPHMSVADNIGYPLKLAGLPAAERTRQVLETVEMVNLTGLENRMPSQLSGGQQQRVALARALVGRPSLMLLDEPLCNLDANLREEMRFEIKELQRTLGITILYVTHDQEIALAISDRLAIMDHAGAIRQVGTPWEIFERPADEFVFRFMGVANFLPARRRGMAMLAAGGEQPVPWGLPDGDAEHWMAGFRPSDVRLARQGDGLRGTVRRASFLGAMTDYLIEVDGASFRTQLDTHEALARGLMFAEGEPCVVGFHDLHWFDAATVAAQAPQGGE
Hit FamilyFIG00284281
Hit Family FunctionThiamin ABC transporter, ATPase component


back to search