Query Sequence
>8500830
MFRMTTLVAALALVLALGGVAFAEKTYINGIDANYPPFAYVDKSGKPAGFDVESMDWIAKKMGFKVTHQPMDWDGIIPNLLAKKIDMVCSGMSITEERRQKVNFSNPYWNVKQVFIAKKGSTLNTDQILKGKVKLGVQRGTSEAEALQKDKEAKGYGYDLRFYDSAPLAIEDVLNGRIDAATMDNLPADDAAAKGKAIQVVGVYGDSEDFGVATRKEDAELLKMINDGYKLLMADPYWEQLKQKHLATK
Hit FamilyFIG01221170
Hit Family FunctionABC-type amino acid transport/signal transduction systems, periplasmic component/domain


back to search