Query Sequence
>8500827
MFDVDFLVDRVFPSLNAGLWMSVKLIVPSAVFGLLFGVIIGIVRVFGKPWMQRIANAYTALFRGVPLLVQLFILYFGLPNIGIYLEPYAASVLGFILCSAAYNSEYVRGALLSIRQGQLRAAQALGFSTMQTLVSIVVPQAVRRALPGCGNEIVYLIKYSSLAYVITCIELTGEAKVLASRTFRFTEVFLVVGAYYLFLVTVASWLLHKLEERFHIPGFGRPRQ
Hit FamilyFIG00782350
Hit Family FunctionABC-type amino acid transport system, permease component


back to search