Query Sequence
>8499887
MERTSPPLPPNFAPVRLPVRAPVCDGLHMPAEWSPHAGCWMAWPCPDPLLEDALDTVRTSFAGVVRAIARFEPVTLLARPEDAEVAAALCGPGVQVVPAPITDAWMRDFGPTFVVDGAGGVAGVDWMFNSWGHTYDEPTHDDDVAQLILSRLGMRRYAAPFILEGGSIHVDGQGTLMTTEQCLLDPRRNAGMTKADFEELFAAYLGVRKVIWLGEGLEGDDTHGHVDIVSCFARPGVVLLHRCDDPEDPNHAVYQDNLRRLQLATDADGKPLEIVTIDQPNRAEHGGKRMDLSYINFYVANGGIVMSAFGAPGGGADSQGALDRVAFETLRRVFPEREVVQVHSLDIFRGGGGIHCITQQQPVGRPLSPF
Hit FamilyFIG00001062
Hit Family FunctionAgmatine deiminase (EC 3.5.3.12)


back to search