Query Sequence
>7026544
MTKPTQPLVVITGASSGIGAAIAKQFSAAGHPLLLLARRVEPMQALELPNSLAIGVDVTDTDAIKAAINQAEAQFGPVGCLINNAGVMLLGQIDTQDPNEWSRMLNINVMGVLNGIHAVLAGMKARKTGTIINISSVAGRKTFPNHAAYCATKFAVHALTENIREEVAMDDVRLITIAPGAVETELLSHTTDDAIKAGYQDWKVQMGGVIAPENVAAAALFAWQQPQNVCVREIVLAPTRQQP
Hit FamilyFIG00440067
Hit Family FunctionShort-chain dehydrogenase/reductase SDR


back to search