Query Sequence
>7026335
MSHILVIGSANADHVMNFEYLPVPGQTLMSRAYRLEHGGKGANQAVACARLCQGDAEVAFICHLGQDSVGNDMRTSWLKDGIKAEGITQVANMSTGTALIFVGDNGENSIGIAAGANADLTPSELEKHYALFANAQFLLIQLETPMETVHHALQTAKRLGITTVLNPAPATSQELDYLKWVDIITPNETEAEALTGIEVNNEEDAELAAQWLHQQGVATVVITLGSKGAFISSAGFTGLIPALTVQAIDTVAAGDTFNGALVVGLSEGMSIAAAVGFANAASAITVTREGAQRAIPYRHEVQR
Hit FamilyFIG00148322
Hit Family FunctionRibokinase (EC 2.7.1.15); Ribokinase in cluster with nucleoside hydrolase (EC 2.7.1.15)


back to search