Query Sequence
>7025621
MPVKIPDHLPAAGILESENIFVMSETRAANQDIRPMKVLILNLMPNKIETETQLLRLLGNTPLQVDVDLLRIHDKESKHTSIDHMNTFYRDFEDVRHKNYDGLIITGAPLGQIDFEEVTYWDHIREIIDWSQQHVTSVLFLCWAAHAGLYHLYGLNRKILQQKRSGVFVHRRTCQHFPLLRGFDDEFFAPHSRFAEMDIEELKQHSELQVLAQSDEAGAYLVLSRNNRNLFVMGHPEYQKSTLNDEYHRDLAQGLNPNVPQNYYRNDDPKDDAIARWHSHGSLLVSNWLNYYVYQLTPYDLSDMSAVTPWESQ
Hit FamilyFIG00001106
Hit Family FunctionHomoserine O-succinyltransferase (EC 2.3.1.46)


back to search