Query Sequence
>7025598
MSAQQATAGISVAGTSAAETSSATPEFAIETRGMTRAFGGINAVEDLDLAIPKGTIYGFLGPNGCGKSTSIRMLTGLLSPTSGDIRVLGETLPGAEEKLRRRIGYMTQKFSLYDNLSVRENLEFVAQIYGLNRRQTKARLAELLSLYDLAGREKQMAGSMSGGQKQRLALAAATLHHPELLFLDEPTSAVDPENRREFWERLFDLCAQGTTILVSTHYMDEAERCHGLAILERGIKRADGSPQQLMAAMGARVVEVSGEDLRKLKQSLISDANVLSAAQIGSRLRVLVQSSIADPLAWLSPRVAGRALTEVRPSLEDVFVTCTGGRAQLTPPNGSQATTVEAQDAT
Hit FamilyFIG00001005
Hit Family FunctionABC-type multidrug transport system, ATPase component


back to search