Query Sequence
>7025534
MKIVIAPDSFKESLSALDVANAIEQGLTQVIPDCEIVKIPVADGGEGTVQSMVDATGGSIVNLEVMGPLGHKVKAHYGILGQQAKGTIAVIEMASASGLHHVPRDLRNPLLTTSYGTGELICDALNRGIKHIILGLGGSATNDGGAGMAQALDILLLDKQGKTLSAGGAALSQLASIDISHAHPLLKECTFEVACDVDNPLCGERGASAIFGPQKGATSEMVSTLDAALSHYADVIAQSGVTDHRNQAGAGAAGGMGLGVMAFLGAELKPGVEIVMQTVGLADKIRGADLVITGEGRIDGQTIFGKTPMGVLKQAQLQNIPTIGVAGCLGDNANAVLEQGMAAIFPIIPHLSPLDDVLANAKTNLTNTARNIGAVLMLGKR
Hit FamilyFIG00000456
Hit Family FunctionGlycerate kinase (EC 2.7.1.31)


back to search