Query Sequence
>7024806
MNPYQAPLADMRFLLEQVFDAPNTWAQLPDIAEMVDMDTASAILEEAAKISAELIHPLNRAGDEQGVLHQDNRVITPDGYKAVYDQYSQGGWVGLCGEPEFGGMGMPKMLGVLVDEMAYSACNAFTLYGSLTAGAALCINAHGSEEIKETYLPKLYSGEWAGAMDMTEPQAGSDLRNIRTRAIPQDDGSYAISGSKIFITGGDHDLTENVIHLVLAKLPESKGISLFLVPKTTVNADGSLGQANGVSVGSIEHKMGLKGSATCVMNFDEAKGYLIGEPNRGLVCMFTMMNYERLAIGIQGLGSAQAAYQMAADYAKERNQGVAAGGSPTGSDSDPIIVHGDVRRMLLTIRAMTEAGRALSVFTGKQLDLAKYAEGEVKAKAARYVGLLTPVAKAFLTDRGLDATIMAQQVFGGHGYIRETGIEQLVRDTRIAQIYEGTNGIQAIDFLGRKVTGDNLATLKEFVAELKAQMREFTQVDAVKVSAVCARLDALVNVAESINEQKLTQPALINASAVDFLDAFGFTLYGFYWLAMLDKAVGAEDKQYAEQKSYLTKFYFDKLLPKADYHLAQVRAGDTSTMAMPAELF
Hit FamilyNo hits found for this sequence


back to search