Query Sequence
>7024672
MSANIDEFDVVIIDTGCANLSSVRFAFERLGAKVLVTDDKASIKAAKRVVLPGVGSAGAAMASLTEKALVELIQGLTQPVLGVCLGMQMLTLLSKERGGQALDCQCLGIIPTEIDELDRQILKAEGLPLPHMGWNQLTFSNPSQVHPLFTGVPAGSYVYFVHSYRAPLSDYTLAQCRYGEDFSAAIGKDNFMGVQFHPEKSAAVGAQILGNFLKMQ
Hit FamilyFIG00010738
Hit Family FunctionImidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-)


back to search