Query Sequence
>7024446
MNDWSIDAARAGYNVTHWSQGFYGISDQGEVTVSPDPKNPDHKIGLNELAKDMVKAGVALPVLVRFPQILHHRVNSLCQAFDQAIQKYEYQADYLLVYPIKVNQQKTVVEEILASQASKEVPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKDNEYIRLALIGEKLGHKVYIVLEKLSELKMVLAESKRLGVKPRLGLRARLAFQGKGKWQASGGEKSKFGLSAAQILTVVDQLKQEDMLDSLQLLHFHLGSQIANIRDIRQGVSEAARFYCELRELGASINCFDVGGGLAVDYDGTRSQSNNSMNYGLSEYANNIVNVLTDICNEYEQPMPRIISESGRHLTAHHAVLITDVIGTEAYQVEEIQPPAEESPQLLHNMWQSWTEISGRADQRALIEIYHDSQSDLQEAQSLFALGQLSLAERAWAEQANLRVCHEVQGLLSTKNRYHRPIIDELNEKLADKFFVNFSLFQSLPDAWGIDQVFPVLPLSGLDKAPERRAVMLDITCDSDGIVDQYVDGQGIETTLPVPAWSAESPYLMGFFMVGAYQEILGDMHNLFGDTNSAVVSIEENGMTNIESVLAGDTVADVLRYVNLDAVDFMRTYEELVNQHIAEEERAQILEELQVGLKGYTYLEDFS
Hit FamilyFIG00002695
Hit Family FunctionBiosynthetic arginine decarboxylase (EC 4.1.1.19)


back to search