Query Sequence
>7024401
MGERDLLGCLTGEHVVLEPLSLSHVAALSLAVTDGELWRLWFTSVPEPSEMKAYVTKALDEKARGESFPFAVRDRLSGEIVGCTRISHWESEHRHLEIGYTWYAKRAQRTGINTESKLLLLTFAFETLDAIAVEFRTHWHNQASRQAIARLGAKQDGVLRNNKILKDGTIRDTVVYSIIDSEWATVKHNLAFRLQQRPVE
Hit FamilyFIG01955816
Hit Family FunctionN-acetylglutamate synthase related protein


back to search