Query Sequence
>7024346
MSNVVSKNSAINVVNLEKSVTTQEGSLTILKGINLDVKQGESVAILGPSGSGKSTLLGLLAALDTPTSGEIWLDGQALSPLNEEQKAALRKQKVSFIFQSFMLVDTLTALENVMLPAELAGVKNAKEKAEAMLGRVGLSHRLTHLPKQLSGGEQQRVAIARAFICEPKVLFADEPTGNLDSVNGHKIADMLFELNQESHTTLILVTHDLQLAKRCQRQLVMDNGHLQEELDSAQSHSVNDNLELSAKEA
Hit FamilyFIG00007923
Hit Family FunctionABC transporter ATP-binding protein YvcR


back to search