Query Sequence
>7023614
MVSRSPFESFQWKSDIFNCESTDIDNFYLQLEQEMSRLGMVEKKLGEVGKYSVSLYQSPAAKSGLPSLLISAGFHGEESAGPWGLLHFLSEASADLFERVNLSILPLVNPTGFKRGHRFNKFGENPNRGFVFENGKPKANESTSVEGKLLLDHAQLLIAASRDGILTCHEDVLSRDAYVYSFEPSQVPGRFSIDLRDTLGGYFPIAEDGEIDGCPVKDGLIFNHFDTSFEACLVRSGARVGACTETPALQNFDQRVLANSAAMTHFLALCAPLCD
Hit FamilyFIG01057269
Hit Family FunctionFIG160851: peptidase


back to search