Query Sequence
>7022788
MTDMPSVTTPALDRYAVFGNPIGHSKSPFIHGQFASLTQQTLSYEAILAPIDGFEASLRAFFQAGGKGANVTVPFKEQAFALCDSLSAEATLAGAVNTLSLLADGTIYGDNTDGLGLVADLVRHLGSLQHKRVLLVGAGGAARGCILPLLKAEVGQLVITNRTQSKAQALVDIFSQVQEGRYSDKLQAVSMSELSGVFDLVINSTSASLAGELPPLSQSIIGNKTACYDMMYGAKPTAFNQWALQQGAAQVIDGLGMLVGQAAKSFALWRGVEPDTSGVLKLLRDKLQVDAQ
Hit FamilyNo hits found for this sequence


back to search