Query Sequence
>6939331
MKVLENVNVALKANVYFDGKVTSRAIYVGGQKQTIGVVLPGEYEFSTTQPEQMQVTSGSFEVLLPGESQWQTFAEGSTFNLDADVSFSIRATDVAEYLCSYL
Hit FamilyFIG01058207
Hit Family FunctionFIG206191: hypothetical protein


back to search