Query Sequence
>6939130
MKIVIAPDSFKESLSAMEVADAIEAGFKRVLPDATYIKLPMADGGEGTVQSLVDATGGTIVPVEVTAPLGNKVEAFFGLLGSAKEKGDSCVRAVIEMAAASGLHLVAPELRNPLLTSSFGTGELILAALERGVTHLILGIGGSATNDGGAGMITALGGKLLKADGSPIALGGGSLAELSHIDLTGLDPRLAGLTIDVACDVNNPLCGPKGASAVFGPQKGATPEMVTLLDANLARYANCIESTLGKPVKDIPGAGAAGGMGAALVGLLGAELKPGIQIVIEALKLADALADADLVITGEGCIDSQTIHGKTPIGVASCAKQFGKPVIGIAGCLSDDCGVVHEHGLDAVFAVVNRAMTLPEALATAGTNIEQTARNVAALYCLSR
Hit FamilyFIG00000456
Hit Family FunctionGlycerate kinase (EC 2.7.1.31)


back to search