Query Sequence
>6938617
MSNIPSELKYASSHEWIRKEDDGTYTVGITEHAQELLGDMVFVELPEVGDTVSAGEDCAVAESVKAASDIYAPISGEVIAVNESLEDSPELVNSDAYGDGWFFRIKPSDESELDSLLDAEGYQAVIDEE
Hit FamilyFIG00000296
Hit Family FunctionGlycine cleavage system H protein


back to search