Query Sequence
>6938323
MQKVIQTHAKAADIFCRDESRVDWHSKALWVLREKRDRAASSLPEWETLRALGSQIKLHTLNQLPGYLEAFEAKCLSQGVKVHWAKDGAEHNRIVHDILSRHGVKKLVKSKSMLTEECHLNPFLEGKGIEVIDTDLGERIIQLNHQPPSHIVVPAIHMKKEEVGDLFHEKLGTPKGESDPTRLTRAARAHLREQFLSADAAMTGVNMAVASEGAVIVCTNEGNADMGANLPKLQLHSMGIDKIVPDLDSAAVLLRMLARNATGQPITTYSSLYRTPKPGGEMHVIIVDNGRSAMMRDKLLGEALKCIRCGGCLNTCPVYRRSGGYSYGHTIPGPIGIAVGADEDDTHSSPWACTLCGSCSFVCPTKVPLDKIIFHRRRLYAERKSLPYGKSGYMPLVGRFMASPLLLDTGMAAARIALKILPHSLLKPMSGAWGKYRELPAAPGSSFEGWVKKNRPELLVKSKGEK
Hit FamilyFIG00138298
Hit Family FunctionPredicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF


back to search