Query Sequence
>6938322
MKIALFTPCLVNQMMPEVAIATLSLLEKLGHQVIFPQGQTCCGQPMTNSGCFNEAKNTTLKLLNAFKGVECDAIVCPAASCLVAAKENFHEFDKSPEAQAVIDKLYELTEFLHDVAPVTQFNRPVAKKLSLQLSCHGIRMLDLAAPSEYMGPRYNKMEALLSRIDGVEICYPERLDECCGFGGTFSVDEGAVSAKMGKDKAQAHANTGADYVVGFDPSCLMHLDGTIRRRQLPIETRHLAQILNDAL
Hit FamilyFIG00000926
Hit Family FunctionPredicted L-lactate dehydrogenase, Fe-S oxidoreductase subunit YkgE


back to search