Query Sequence
>6937550
MAIHDRAGKQAQQGDLVNIPKLMSHYYRLLPDASDPAQKVSFGTSGHRGCAFHRSFNEQHILAIAQAVVDWRTQADITGPLYLGMDTHALSQAAYLSVIEVLIANKVQVLAQRDDAYTPTPVVSQAIVAANRHQTGEDALLSDGIIITPSHNPPQDGGIKYNPPHGGPAEGDITSWIETRANHYLAHGLDGVRRVNYGIASGLSLLKHVDLISPYVQSLAEVIDMAAIAKAGVRMGVDPLGGSGIHYWQPIAEHYGLNIEVVNQAIDPTFDFMPLDKDGKIRMDCSSPYAMAGLLVHKDEFDICVGNDPDYDRHGIVCPGSGLMDPNHYLAVAIDYLLGHRPNWAKTLAVGKTLVSSALIDKVCMAHGVPLMEVPVGFKWFVDGLADSSVCFGGEESAGAAFLKMDGSTWCTDKDGFILALLAAEILAVTGKTPAERYEELVAEHGRSFYKRIDSPLNPKMKAKFGALNAQTLGATSVAGDAITAVLTKAPGNGAAIGGIKVCTDKGWFAARPSGTEPLFKLYAESFVSEAHLGELISDAQSLLGTALKAIKLSQFDMKV
Hit FamilyFIG00000901
Hit Family FunctionPhosphoglucomutase (EC 5.4.2.2)


back to search