Query Sequence
>6937493
MGFFSRIRRLISGAPTIEGGIAILAPVSGEIYPIEKVPDVVFAEKIVGDGIAIAPEGDTIYAPIDGTIGKIFETNHAFSIESPQGLELFVHFGVGTVELRGNGFKRLAEEGQQVKAGDPILAFDLEYLREHADSLLTPVVLANMEDIKYLEKSQGRVEAGKDVIFTVEI
Hit FamilyFIG00668821
Hit Family FunctionPTS system, glucose-specific IIA component


back to search