Query Sequence
>6937470
MSSVINNPSSCQFIGGQWQPGHGKGFESINPANGEVIWCGNGANAEQVDTAVKAARSAFYNWSAMPLAERLAIIEAFGAQLGEHSEAMARLIAEETGKALWESRTEVAAMTGKIAISIRAHSERTGTVENPMPGARAFIRHKPHGVVAVFGPYNFPGHLPNGHIVPALIAGNTVLFKPSELTPKVAQFTVELWQKAGLPAGVINLLQGEVETGKALAGHPGIDGLFFTGSSNTGHLLHQQYAGQPGKILALEMGGNNPLIVKDVANVNAAVHDIIQSAFISSGQRCTCARRLFIKKDANGDAILAKLIEASRQIRVDEPFAENQPFYGAMISAKAAAAMVKAQTDIQSLGGISLLELKQPDLALGFVTPGIIDVTHVKALPDEEHFGPLLKVYRYDDFDAAIDEANNTAFGLSAGLLADNEADYDHFFRRIRAGIVNWNKPITGASSAAPFGGIGASGNHRASAFYAADYCAYPVSSVEASSVSLPASLSPGLSI
Hit FamilyFIG00014703
Hit Family FunctionSuccinylglutamic semialdehyde dehydrogenase (EC 1.2.1.71)


back to search