Query Sequence
>6937325
MSNTLVLVLNCGSSSLKFAILDATNGDEKISGLAECFGLENARIKWKLRGEKHEASLGAFSAHREAVEYIVNKILVNEPELKGQLIAIGHRIVHGGEKFTHSVIIDDAVLKGIEDCASLAPLHNPAHLIGIRAAQASFPSLPQVAVFDTAFHQSMPDRAYIYALPYKLYREHGIRRYGMHGTSHLFVSREAAKALGKDVNDTNVICAHLGNGASVTAVKGGKSVDTSMGLTPLEGLVMGTRCGDLDPSIIYHLVHQLGYTLDEVNNLMNKQSGLLGISELTNDCRGIEEGYAEGHKGATLALEIFCYRLAKYIASYTVPLGRLDAIVFTGGIGENSDLIREKVLNLLEIFKFEVDSERNKAARFGNQGVITKEGSPIAMVIPTNEEWVIAEDSLRLVNK
Hit FamilyFIG00067248
Hit Family FunctionAcetate kinase (EC 2.7.2.1)


back to search