Query Sequence
>6936221
MSQFQSIDVADFYDSETFARIQEFAKDKATPFVVIDTNIIAKQYDDMVTNFPFANVYYAVKANPAKEILTLLKDKGSNFDIASIYELDMVMAVGVTADRVSFGNTIKKRKDVRAFYERGVRLFASDSEADLRMIAEEAPGSKVYVRILTEGSQTADWPLSRKFGCQNEMAYELLALAKELGLDPYGISFHVGSQQRDIGAWDAAIGKVKVLFDRLREDHGIVLKMINMGGGFPANYIDKTNQLGVYAQQIKHFLKEDFGDELPEIILEPGRSLISNAGVLISEVVLISRKSHTALERWVYTDVGKFSGLIETMDEAIKYPIFTEKKGELDKCVIAGPTCDSADIMYEHYAYGLPADLAIGDRLYWLTAGAYTTTYSAVCFNGFPPLKDYYL
Hit FamilyFIG00001604
Hit Family FunctionOrnithine decarboxylase (EC 4.1.1.17)


back to search