Query Sequence
>6936060
MSVTNKVLVLKVGGALLQCEMGMARLMDTARQLLEKGEQVVLVHGGGCLVDEQLKANGMETVKLDGLRVTPAEQMPIIAGALAGTSNKLLQGAAAKAGVVSMGMSLCDANMVTAVIKDERLGMVGEVSPKDAKALEFILAQGWLPIISSIAMGEDGELLNVNADQAASVLAKLLGGKLVLLSDVSGVLDGKGKLIPSLNSQEIDELVKLGVIEKGMKVKVEAALEVAQWLGQPVQVASWRDSGQMAALIKGEAVGTQIQPQE
Hit FamilyFIG00000383
Hit Family FunctionAcetylglutamate kinase (EC 2.7.2.8)


back to search