Query Sequence
>5210737
MLDAINSSLFTPIGEDGLIGIYLILNGLKVTLIVTLFAMILGAILGVATTLMKMSSRWYLRWPANLYVGVIRGTPVVVQLVILYFIVLATWDVDKVSAAIIAFGLNSGAYISEIIRAGIQAVDKGQTEAARSLGLSQAVTMKEVILPQAIKNILPALGNEFIVLLKETAVIGFIGGVDLMRSGEIIRSRTFEDSVPLFTCALIYLALTYSFTFMLSKFEKRLKQSD
Hit FamilyFIG01814011
Hit Family FunctionAmino acid transport system permease protein


back to search