Query Sequence
>5210054
MPLLDIRNLTIELDTPHGRVKALERVSLTLNPGEVHGLVGESGSGRTLLAKAILGIPGHNWTIQADRMMWDGQNLMDMSPSERRVLMGSEMAMIFQDPISSLDPAIAVGTQIIEAMPENKELPWWKRGSDKRKKAQQWLHKVGIKETQKIMSSYAWELSDGECQKVMIAIAVANQPRLLIADEPTNSMEVRTQAQIFRLLSKLNQLQNVSILLISHELETLSQWCDRLTVMYSGQVMESGVTSDVIANPYHPYTKALLDNIPDYSNPEHHKTMMQTLPGSAPALQHLPIGCRLGPRCPQAQKLCVNQPSLCHQKDRYFACHFPYHNEPCHEEPLTKS
Hit FamilyNo hits found for this sequence


back to search