Query Sequence
>5209453
MRDTLMLSKDFLQLTLDNPVGLEAFEFTLGQHTQVSVWDTGVIQFEPLVTYEANQESEQDGKEEALKSIVLSSAVHGNETAPIELCDQLITALLSETLIARHRLLFLIGNPPAILNGTRFVEENLNRLFSGAHAKGESNAERVRAKKLEQYVDRFFNAAPKDGSRYHYDLHTAIRASKHEKFAIYPYPHGAPYSGEQIMFLAACGINTVLFHHEPTTTFSYFSAHGYQAHAFTIELGKVMPMGQNDMTRFIAVKEMLTRLVSGRDLELGEFDPSQVNLYQVHRSINKQFDDFSFTFADDVENFTAFPRGYILAKDGGTEIKVEAESESIVFPNANVPVGQRTVLCLVPAKDYRVV
Hit FamilyFIG00001800
Hit Family FunctionSuccinylglutamate desuccinylase (EC 3.5.1.96)


back to search