Query Sequence
>5209440
MTLDLTLYVKFFLGLVAIINPIGLLPVFVSLTSHQTEAERNHTGKVANFAVVVILLVTIIAGQHILNMFSISLSAFRIAGGTLIAIIAMSMLQGKLGEVKRNQEEDREASGMESVAVVPLALPLMAGPGAISSVIVSAAQHNTFSDLIGMSITVVIFGLTSFTLFRMAPVIFKLLGKTGINVITRLMGLLMLSIGIEVMAAGFKGLFPSLIGS
Hit FamilyFIG00524042
Hit Family FunctionPutative membrane protein


back to search