Query Sequence
>5209240 FitnessBrowser__PV4:5209240
MSATTQIDHQFDRQHIWHPYTSMTQALPVYGVVSAEGCELILDDGRRLIDGTSSWWACVHGYGHPYILEAMQKQLSTLSHVMFGGITHPSAIAVSKKLLAMTSDNLTKVFLADSGSIAVEVAMKMALQYWQGRGAPSKQRILTVKHGYHGDTFAAMSVCDPEGGMHTMFGEAVTQQLFAPAPKTPFGETLIADDLEAMEALLNAHHQTIAAVIIEPIMQGAGAMHFYSADYLKGLRALCDRYKVLLILDEIATGFGRTGKLFAYQHAGIEADILCLGKALTGGYISLAATLCSDEVALGISDSPSGVFMHGPTFMGNPLACAAASASLDLINQHQWPEQVAAIEQQMKQELATASAIEGVKAVRCLGAVGVIEMTRSVNTAALQQAFVDRGVWVRPFSSYIYIMPPYTISAQQLSRLTQAMLEVAAIAGAEAKASRGDEASFISHG
Hit FamilyFIG00012547
Hit Family Function


back to search