Query Sequence
>5209191
MDFNLNEDQRQFAELATQFAQEELAPFAAKWDEEHHFPKDVIQKAGELGFCSLYSPESEGGMGLSRLDSSIIFEQLAMGCTATTAMLTIHNMATWMVTSFGSQTLRDEWSEALTTGNKLASYCLTEAGAGSDAASLKTKAVREGDEYVISGAKMFISGAGSTELLVVMCRTGDAGPKGISAIAIPADAAGISYGKAEDKMGWNAQPTREITFDKVRVPVTNLLGEEGQGFTFAMKGLDGGRINIATCSVGTAQAALERAQQYMNERQQFGKPIAAFQALQFKLADMATELVAARQMVRLAAFKLDSGDPEATAYCAMAKRFATDVGFNVCDSALQLHGGYGYIREYPLERHFRDVRVHQILEGTNEIMRLIIARRLLDENASQIL
Hit FamilyFIG01304405
Hit Family FunctionBranched-chain acyl-CoA dehydrogenase (EC 1.3.99.12)


back to search