SEED Viewer version 2.0

Welcome to the SEED Viewer - a read-only browser of the curated SEED data.
For more information about The SEED please visit theSEED.org.
For daily updates on SEED activity visit the Daily SEED

»Navigate Startpage Organisms Browse Subsystems Curate Subsystems Scenarios FigFams BLAST Search Visit the Daily SEED Request a Subsystem »FIGfam Home Download »Help What is the SEED HowTo use the SEED Viewer Submitting Data to SEED Contact Register I forgot my Password

Query Sequence	>5208392 MSTKLANPAPLGLMGFGMTTVLLNIHNAGFFAIDAMILAMGIFYGGLGQVLVGMMCFKRGDTFGTTAFTSYGLFWLTLVGLIMLPKLGLAAASPSHFMGWYLSLWGLFTAFMFVGSLRYPRAKQVVFGSLTILFFLLAARDFTGSELIGMIAGFEGIFCGASAIYFAMAQVLNQEYGRVILPIGEVKA
Hit Family	FIG01059453
Hit Family Function	Gpr1/fun34/yaaH family protein

back to search